PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_016808
Common NameDcLasD
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family WRKY
Protein Properties Length: 633aa    MW: 68328.3 Da    PI: 6.2123
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_016808genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY24.94e-082452713360
                  --EEEEEE-SSSTTEEEEEEES--SS-- CS
         WRKY  33 pvkkkversaedpkvveitYegeHnhek 60 
                  +vkkkvers+ +++++ei+Y+g Hnh+k
  DCAR_016808 245 KVKKKVERSH-EGHITEIIYKGAHNHPK 271
                  69********.***************85 PP

2WRKY103.11.6e-32424482159
                  ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
         WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                  ldDgy+WrKYGqK+vkg+++prsYY+Ct agC+v+k+ver+++d k v++tYeg+Hnh+
  DCAR_016808 424 LDDGYRWRKYGQKVVKGNPNPRSYYKCTNAGCTVRKHVERASHDLKSVITTYEGKHNHD 482
                  59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.801.8E-4245272IPR003657WRKY domain
Gene3DG3DSA:2.20.25.807.6E-37409484IPR003657WRKY domain
SuperFamilySSF1182901.57E-28416484IPR003657WRKY domain
PROSITE profilePS5081138.32419484IPR003657WRKY domain
SMARTSM007741.9E-37424483IPR003657WRKY domain
PfamPF031066.2E-25425482IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009409Biological Processresponse to cold
GO:0009555Biological Processpollen development
GO:0009846Biological Processpollen germination
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 633 aa     Download sequence    Send to blast
MGGYNDGPLA GEWMPPSPSP RSFFSSMLGD DVSFRSITDL SSDNRGGTLF SPPADNNVGA  60
NSDEKNDGRR SADEVQAINQ NSPSEQKLSL RKGLSERMAA RAGFSAPRLD TESIKPADLS  120
QSSGMQSPYL TIPPGLSPTT LLDSPVFLSN SLVQPSPTTG KFPFASGGNG RSSIFMMEGT  180
DKRKDDFFDN IYTSSFAFKP AAESSPSLFL GGGASSNVPH QSLPGMEISG QPDNSYLPQS  240
VEPEKVKKKV ERSHEGHITE IIYKGAHNHP KPPPNRRSGI GSSNALSEMQ LDMAEQNGSA  300
VDVDPALTVM KKSGASYWRH DNFEVTSSAA MGPEYGNNPS TLQAAGGAQL ESGDQVDRST  360
TFSNDEDDER GTHGSVSIDY DGEEDESESK RRKVEAYATE VSGATRAIRE PRVVVQTTSE  420
VDILDDGYRW RKYGQKVVKG NPNPRSYYKC TNAGCTVRKH VERASHDLKS VITTYEGKHN  480
HDVPAARNSS HANSGVTNPV PSSAGASQSH AHRSEVAQLQ NNMARFERPQ SLGSFGLPGR  540
QQMGPSHGFG FGMNQPSLAN LGMAGLVPNE SKMPAMPNHP FFGQPRPMND MDFMLPKGEP  600
KQEPMSEPSL NNSNGTSVYQ QYMSRYSLGP QM*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2lex_A3e-37415485878Probable WRKY transcription factor 4
1wj2_A3e-37415485878Probable WRKY transcription factor 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB2051820.0AB205182.1 Daucus carota DcLasD mRNA for putative lateral suppressor region D protein, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008246415.10.0PREDICTED: probable WRKY transcription factor 2
RefseqXP_008246423.10.0PREDICTED: probable WRKY transcription factor 2
RefseqXP_008246431.10.0PREDICTED: probable WRKY transcription factor 2
RefseqXP_008246438.10.0PREDICTED: probable WRKY transcription factor 2
TrEMBLQ5DVX10.0Q5DVX1_DAUCA; Putative lateral suppressor region D protein
STRINGVIT_19s0015g01870.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA37112341
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G26440.11e-114WRKY DNA-binding protein 34